> ## Documentation Index > Fetch the complete documentation index at: https://docs.kallima.bio/llms.txt > Use this file to discover all available pages before exploring further. # Register a source antibody > Register a new parental (source) antibody under a project. Validates VH/VL sequences are real amino-acid strings and enforces the mAb-vs-nanobody constraint: ``mab`` requires both VH and VL; ``nanobody`` is single-domain so ``vl_sequence`` must be null. **Idempotency.** Send a unique ``Idempotency-Key`` header per logical submit. A replay with the same key returns the cached 201; a replay with a different body returns ``409 idempotency_mismatch``. Cost: this is a **write** — it burns rate + quota but does **not** spend credits (source antibodies are metadata, not compute jobs). ## OpenAPI ````yaml /api-reference/openapi.json post /v1/source-antibodies openapi: 3.1.0 info: title: Kallima API description: >- Antibody design API — humanization, structure, stability, immunogenicity, complex prediction, and codon optimization. version: 0.1.0 servers: [] security: [] tags: - name: identity description: >- Caller identity and credit balance — use ``GET /v1/me`` to inspect the resolved org, plan, and compute budget before submitting jobs. - name: projects description: >- Projects — top-level containers for source antibodies and therapeutic candidates. - name: source-antibodies description: Source (parental) antibody sequences registered under a project. - name: variants description: >- Variants descended from a therapeutic candidate — the unit of work for pipelines. - name: jobs description: >- Long-running pipeline jobs: humanization, structure, stability, immunogenicity. Submit and poll. Deprecated in favor of resource-per-job-type endpoints (``humanizations`` and the other Phase 3 resources); scheduled for removal in ``/v2``. - name: humanizations description: >- Humanization pipeline runs — typed submit body and typed per-strategy results. First of the Phase 3 resource-per-job-type endpoints; the generic ``/v1/jobs`` shape is deprecated in favor of this. - name: structure-predictions description: >- ImmuneBuilder structure predictions — typed submit body and typed PDB / pLDDT / CDR results. Phase 3 resource-per-job-type endpoint. - name: stability-analyses description: >- Stability analyses — typed submit body and typed thermostability / aggregation / developability scorecard. Phase 3 resource-per-job-type endpoint. - name: immunogenicity-analyses description: >- Immunogenicity analyses — typed submit body and typed MHC-I / MHC-II / B-cell epitope + risk-score results. Phase 3 resource-per-job-type endpoint. - name: uploads description: >- Presigned Supabase Storage slots for caller-supplied files (e.g. antigen PDBs for complex prediction). The API never proxies bytes — clients PUT directly to the returned URL. - name: antigens description: >- Target protein sequences scoped to a project — the docking partner in a complex prediction. Register once, reference by ``antigen_id`` at submit time. - name: complex-predictions description: >- Boltz-2 antibody-antigen complex predictions — typed submit body and typed docked-PDB / iptm / interface-residues results. Phase 3 resource-per-job-type endpoint. Complex runs are long-running (~20–40 min on GPU); always poll, never hold the connection. - name: therapeutic-candidates description: >- Therapeutic candidates — the top-of-lineage object under a project. Creating one auto-creates a baseline variant (``v1``) and its chain rows atomically; pipelines submit against the variant. Junction endpoints manage many-to-many links to source antibodies and antigens. - name: adc-designs description: >- ADC (antibody-drug conjugate) designs — catalog records attaching a linker + payload + conjugation method to a therapeutic candidate. Run the rule-based developability analysis via ``POST /v1/adc-designs/{id}/analysis``; pass ``structure_job_id`` to include SASA-based conjugation-site accessibility. - name: codon-exports description: >- Codon optimization exports — submit a batch of jobs (one per variant), poll until ``variable_cds`` is populated, then download the assembled CDS as FASTA, CSV, or GenBank+ZIP. Requires the Structure plan or above. - name: webhooks description: >- Webhook endpoint registration — register HTTPS URLs to receive signed event deliveries when jobs complete or fail. Signing uses HMAC-SHA256; see ``POST /v1/webhooks`` for verification details. - name: webhook-deliveries description: >- Webhook delivery log — inspect past delivery attempts and manually retry failed ones via ``POST /v1/webhook_deliveries/{id}/retry``. paths: /v1/source-antibodies: post: tags: - source-antibodies summary: Register a source antibody description: |- Register a new parental (source) antibody under a project. Validates VH/VL sequences are real amino-acid strings and enforces the mAb-vs-nanobody constraint: ``mab`` requires both VH and VL; ``nanobody`` is single-domain so ``vl_sequence`` must be null. **Idempotency.** Send a unique ``Idempotency-Key`` header per logical submit. A replay with the same key returns the cached 201; a replay with a different body returns ``409 idempotency_mismatch``. Cost: this is a **write** — it burns rate + quota but does **not** spend credits (source antibodies are metadata, not compute jobs). operationId: create_source_antibody_v1_source_antibodies_post requestBody: content: application/json: schema: $ref: >- #/components/schemas/app__routers__v1_source_antibodies__SourceAntibodyCreate required: true responses: '201': description: Successful Response content: application/json: schema: $ref: '#/components/schemas/SourceAntibodyOut' '400': description: Malformed request body or parameter. content: application/problem+json: schema: $ref: '#/components/schemas/ProblemDetails' '401': description: Missing or invalid API token. content: application/problem+json: schema: $ref: '#/components/schemas/ProblemDetails' '402': description: >- Payment required — insufficient credits or the caller's plan is below the required tier. content: application/problem+json: schema: $ref: '#/components/schemas/ProblemDetails' '404': description: Resource does not exist in the caller's organization. content: application/problem+json: schema: $ref: '#/components/schemas/ProblemDetails' '422': description: Request failed validation. content: application/problem+json: schema: $ref: '#/components/schemas/ProblemDetails' '429': description: >- Rate limit or monthly write quota exceeded. `Retry-After` holds the number of seconds until the next admitted request. content: application/problem+json: schema: $ref: '#/components/schemas/ProblemDetails' headers: Retry-After: description: Seconds until the caller may retry. Present on 429 responses. schema: type: integer minimum: 1 X-RateLimit-Limit: description: Per-minute rate ceiling for this API token's plan. schema: type: integer X-RateLimit-Remaining: description: Requests remaining in the current rate window. schema: type: integer X-RateLimit-Reset: description: HTTP-date when the rate window resets. schema: type: string format: http-date X-Quota-Limit: description: Monthly write ceiling for this API token's plan. schema: type: integer X-Quota-Remaining: description: Writes remaining in the current monthly window. schema: type: integer X-Quota-Reset: description: >- HTTP-date when the monthly write quota resets (always the 1st of next month UTC). schema: type: string format: http-date security: - HTTPBearer: [] components: schemas: app__routers__v1_source_antibodies__SourceAntibodyCreate: properties: project_id: type: string title: Project Id description: >- UUID of the project to register this antibody under. Must belong to the caller's org. examples: - 7b4a3c0f-2e6d-4c7a-9e8f-1d3b5a2c4e6f name: type: string maxLength: 120 minLength: 1 title: Name description: Display name (1–120 chars). examples: - Adalimumab species_origin: type: string title: Species Origin description: >- One of: ``mouse``, ``rabbit``, ``llama``, ``human``, ``synthetic``, ``other``. examples: - mouse molecule_type: type: string title: Molecule Type description: >- ``mab`` (paired VH+VL) or ``nanobody`` (single-domain VHH). Nanobodies must omit ``vl_sequence``; mAbs require it. default: mab examples: - mab vh_sequence: type: string title: Vh Sequence description: >- Heavy-chain variable region amino-acid sequence (single-letter code). examples: - QVQLVESGGGLVQPGGSLRLSCAASGFTFS... vl_sequence: anyOf: - type: string - type: 'null' title: Vl Sequence description: >- Light-chain variable region. Required for ``mab``; must be null for ``nanobody``. examples: - DIQMTQSPSSLSASVGDRVTITCRASQGIRN... type: object required: - project_id - name - species_origin - vh_sequence title: SourceAntibodyCreate description: Body for ``POST /v1/source-antibodies``. example: molecule_type: mab name: Adalimumab project_id: 7b4a3c0f-2e6d-4c7a-9e8f-1d3b5a2c4e6f species_origin: mouse vh_sequence: >- QVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSAITWSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDRGTTMVPFDYWGQGTLVTVSS vl_sequence: >- DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKRLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIK SourceAntibodyOut: properties: id: type: string title: Id description: Opaque source antibody identifier (UUID). examples: - a1b2c3d4-e5f6-4789-89ab-cdef01234567 name: type: string title: Name description: Display name. examples: - Adalimumab species_origin: type: string title: Species Origin description: >- One of: ``mouse``, ``rabbit``, ``llama``, ``human``, ``synthetic``, ``other``. examples: - mouse molecule_type: type: string title: Molecule Type description: Either ``mab`` (paired VH+VL) or ``nanobody`` (single-domain VHH). examples: - mab vh_sequence: type: string title: Vh Sequence description: Heavy-chain variable region amino-acid sequence. examples: - QVQLVESGGGLVQPGGSLRLSCAASGFTFS... vl_sequence: anyOf: - type: string - type: 'null' title: Vl Sequence description: >- Light-chain variable region amino-acid sequence. ``null`` for nanobodies. examples: - DIQMTQSPSSLSASVGDRVTITCRASQGIRN... project_id: type: string title: Project Id description: Parent project this antibody is registered under. examples: - 7b4a3c0f-2e6d-4c7a-9e8f-1d3b5a2c4e6f created_at: type: string title: Created At description: ISO-8601 timestamp (UTC) when the record was created. examples: - '2026-04-21T14:05:00+00:00' type: object required: - id - name - species_origin - molecule_type - vh_sequence - project_id - created_at title: SourceAntibodyOut description: A source (parental) antibody sequence registered under a project. example: created_at: '2026-04-21T14:05:00+00:00' id: a1b2c3d4-e5f6-4789-89ab-cdef01234567 molecule_type: mab name: Adalimumab project_id: 7b4a3c0f-2e6d-4c7a-9e8f-1d3b5a2c4e6f species_origin: mouse vh_sequence: >- QVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSAITWSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDRGTTMVPFDYWGQGTLVTVSS vl_sequence: >- DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKRLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIK ProblemDetails: additionalProperties: true description: RFC 9457 problem+json body returned by every non-2xx response. example: code: insufficient_credits credit_balance: 0 credit_cost: 1 detail: Humanization costs 1 credit; balance is 0. instance: /v1/jobs request_id: req_01JBX6Y6ZK6N8Q7YJ0F5VX2C3D status: 402 title: Insufficient credits type: https://docs.kallima.bio/errors/insufficient_credits properties: type: description: >- Stable URI identifying the error class. Dereferenceable at docs.kallima.bio/errors/{code}. examples: - https://docs.kallima.bio/errors/insufficient_credits title: Type type: string title: description: Short human-readable summary of the error class. examples: - Insufficient credits title: Title type: string status: description: HTTP status code. Matches the response status line. examples: - 402 title: Status type: integer detail: description: Human-readable explanation with values substituted. examples: - Humanization costs 1 credit; balance is 0. title: Detail type: string instance: description: The specific request URI that failed. examples: - /v1/jobs title: Instance type: string code: description: >- Machine-readable short code. SDKs switch on this, not on `title`. See app.errors.ErrorCode for the full taxonomy. examples: - insufficient_credits title: Code type: string request_id: anyOf: - type: string - type: 'null' default: null description: ULID stamped on every request. Include when contacting support. examples: - req_01JBX6Y6ZK6N8Q7YJ0F5VX2C3D title: Request Id required: - type - title - status - detail - instance - code title: ProblemDetails type: object securitySchemes: HTTPBearer: type: http scheme: bearer ````